PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036515
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1568aa    MW: 170167 Da    PI: 5.9608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036515genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.4e-07784825346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       W+ eE e+++d  +  G++ +k+I+ ++  ++t  +c+++++k
      Lus10036515 784 CWSLEEREIFIDKLAICGKD-FKKISFYLE-HKTTADCIEFYYK 825
                      6*****************99.*********.***********98 PP

2Myb_DNA-binding31.25.1e-109931031444
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44  
                       WT eE   +v+av ++G++ ++ I+r++  +R+ +qck ++
      Lus10036515  993 WTDEEKTAFVRAVSLYGKD-FAFISRCVR-TRSQEQCKVFF 1031
                       *****************99.*********.********776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-11768829IPR009057Homeodomain-like
PROSITE profilePS5129313.822780831IPR017884SANT domain
SMARTSM007172.2E-6781829IPR001005SANT/Myb domain
PROSITE profilePS5129311.5459881039IPR017884SANT domain
SMARTSM007174.7E-99891037IPR001005SANT/Myb domain
SuperFamilySSF466891.17E-99911038IPR009057Homeodomain-like
PfamPF002495.3E-89931031IPR001005SANT/Myb domain
CDDcd001673.20E-79931031No hitNo description
Gene3DG3DSA:1.10.10.601.6E-59931032IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1568 aa     Download sequence    Send to blast
MPPEPLPWDR KKHESSSSSL GSTPRWRDCP AGHYGSHRDF SPRWAGGSTE FRRPSGHGKQ  60
GGWHLYADES GYGYGPSRSN DKMKEATNGR PLFSRGDGKC GRSGRDNRGP YGQRDWGAYS  120
WDMSNGSTNG PRRPYDVSND QMSVDDMLTC PPSHPPNSDF GSTWDQLQLR QQHGNNEDGG  180
NALGSGQRGD KDNSLDWRPL KWTRTGSLSS RGSGYSHSSS SMNLGAVKAN GGKNEMIPKN  240
GTPIHSTSGD VTVVRADSVT LSDETMSRKK PRLKWGEGLA KYEKKRVEGP ETSVTRDDTT  300
LFTNSLEPVH SRSSSLPDKS PRQMVYPECV SPATPSSIAC SSSPGVEDKV FCPVVSVDND  360
ASNLCGSPSV GSQGREEFSF SLEKLDMGSI PNLGSSLIEM IQSEDLCIVD SCFEKSTGMN  420
KLLVWKGNAL KALETTETEI DILENELKSL KSDSKSKLLG SSPSDSLTIS GHAIACSEQG  480
TLCRDDLCRP VSSMDEAVDG IPNPDDAFED GCAMDDDIDS PGTATSKFVE PLISVSDMVR  540
CTQHSGVAAD ESSNLMVEKG SALAACNVSS IHCNNNALLS ASKSSVEDGY SNLCTAILAS  600
NKESASTVGE EFYRLLPRDR CSVNHSGVAN ILSGQTDALV MKKFLARRRL MKIKEKIVAL  660
KFKSLQHLWR EDMHLLSVNK FKAKSQKKFE SSLRPIYSIH KKHRSSSRMR ICSPGSMGLV  720
LSPEMLNFSR KLLADCSVKV YRDKLKMPIQ ILDDSERRVS MFISGNGLVE DPFAVERERA  780
MINCWSLEER EIFIDKLAIC GKDFKKISFY LEHKTTADCI EFYYKNHKSD SFGKVKKNKQ  840
YKSLTNYLMS SGKKWNREMG TAPLDTLGAA SVVAAHPDRK MGSRKVSSSK IFIRGYDKCK  900
ILQGDDGNSE RLNNYDVLVN ERETAAADVL AGISGSMSSC ITTSADRAEG FYDYNARRTD  960
TTDRRPSISD VTQNVDEETC SDESCGEMDP ADWTDEEKTA FVRAVSLYGK DFAFISRCVR  1020
TRSQEQCKVF FSKANKCLGL DHIHSGIGKL DPSLSEDANE GGSDMEDATV DGSEEIPSKL  1080
DLDPLPRVMC TAGILKQDVS DGRVGINLET DLNVSDEKDV AGAIEEENLM AVDTVKGHLV  1140
QSTHLADGEV INGCGRVSLR MNGQTVQIES GVTEGERDCQ TKEVQHLPLD MGSSSDDSLV  1200
GNITQRQVEV NSVEKSSSMK VNNNLVSAVS VTLNSAATHC DKALDSGEIS GSVQENCSKL  1260
DGSGYVQPSV CCPVVNHGEY SESGCSKVQT LTEKVTMGNT SDAKLLLNAE QFMGNQLVAE  1320
EGSCLENSSN CEGQCSVPEL PLLSQPGSAT NMEKRSRNGD VKLFGKILSN PVSSSSSQKP  1380
VAAHGSGEKS TQPQRTLKFN GDHSADDTLV NFDKNNSAGV KNVPIRSYGF WDGSRIQTGL  1440
TSLPDSAILL AKYPAAFTNF QGSSSPKLDP VALATTSKNI ERSMNGVVSI HQRGDINSSS  1500
SSSNALLDFQ RYISTDGSKK VEQQEGGKGL ESRTVSDPVA AIKIHFAKAA DQNCGDSEAP  1560
AQGAMVK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267285RKKPRLKWGEGLAKYEKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086506.10.0PREDICTED: uncharacterized protein LOC105645502
TrEMBLA0A067K1T60.0A0A067K1T6_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-105MYB family protein